<?xml version='1.0'?>
<!DOCTYPE art SYSTEM 'http://www.biomedcentral.com/xml/article.dtd'>
<art>
   <ui>1477-5956-6-11</ui>
   <ji>1477-5956</ji>
   <fm>
      <dochead>Research</dochead>
      <bibl>
         <title>
            <p>Proteomic analysis of the EhV-86 virion</p>
         </title>
         <aug>
            <au id="A1" ca="yes">
               <snm>Allen</snm>
               <mi>J</mi>
               <fnm>Michael</fnm>
               <insr iid="I1"/>
               <email>mija@pml.ac.uk</email>
            </au>
            <au id="A2">
               <snm>Howard</snm>
               <mi>A</mi>
               <fnm>Julie</fnm>
               <insr iid="I2"/>
               <email>jah71@cam.ac.uk</email>
            </au>
            <au id="A3">
               <snm>Lilley</snm>
               <mi>S</mi>
               <fnm>Kathryn</fnm>
               <insr iid="I2"/>
               <email>k.s.lilley@bioc.cam.ac.uk</email>
            </au>
            <au id="A4">
               <snm>Wilson</snm>
               <mi>H</mi>
               <fnm>William</fnm>
               <insr iid="I1"/>
               <insr iid="I3"/>
               <email>wwilson@bigelow.org</email>
            </au>
         </aug>
         <insg>
            <ins id="I1">
               <p>Plymouth Marine Laboratory, Prospect Place, The Hoe, Plymouth, PL1 3DH, UK</p>
            </ins>
            <ins id="I2">
               <p>Cambridge Centre for Proteomics, Department of Biochemistry, University of Cambridge, Tennis Court Road, Cambridge, CB2 1QR, UK</p>
            </ins>
            <ins id="I3">
               <p>Bigelow Laboratory for Ocean Sciences, 180 McKown Point, PO Box 475, W. Boothbay Harbor, Maine, 04575-0475, USA</p>
            </ins>
         </insg>
         <source>Proteome Science</source>
         <issn>1477-5956</issn>
         <pubdate>2008</pubdate>
         <volume>6</volume>
         <issue>1</issue>
         <fpage>11</fpage>
         <url>http://www.proteomesci.com/content/6/1/11</url>
         <xrefbib>
            <pubidlist>
               <pubid idtype="pmpid">18346272</pubid>
               <pubid idtype="doi">10.1186/1477-5956-6-11</pubid>
            </pubidlist>
         </xrefbib>
      </bibl>
      <history>
         <rec>
            <date>
               <day>23</day>
               <month>1</month>
               <year>2008</year>
            </date>
         </rec>
         <acc>
            <date>
               <day>17</day>
               <month>3</month>
               <year>2008</year>
            </date>
         </acc>
         <pub>
            <date>
               <day>17</day>
               <month>3</month>
               <year>2008</year>
            </date>
         </pub>
      </history>
      <cpyrt>
         <year>2008</year>
         <collab>Allen et al; licensee BioMed Central Ltd.</collab>
         <note>This is an Open Access article distributed under the terms of the Creative Commons Attribution License (<url>http://creativecommons.org/licenses/by/2.0</url>), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.</note>
      </cpyrt>
      <abs>
         <sec>
            <st>
               <p>Abstract</p>
            </st>
            <sec>
               <st>
                  <p>Background</p>
               </st>
               <p><it>Emiliania huxleyi </it>virus 86 (EhV-86) is the type species of the genus <it>Coccolithovirus </it>within the family <it>Phycodnaviridae</it>. The fully sequenced 407,339 bp genome is predicted to encode 473 protein coding sequences (CDSs) and is the largest <it>Phycodnaviridae </it>sequenced to date. The majority of EhV-86 CDSs exhibit no similarity to proteins in the public databases.</p>
            </sec>
            <sec>
               <st>
                  <p>Results</p>
               </st>
               <p>Proteomic analysis by 1-DE and then LC-MS/MS determined that the virion of EhV-86 is composed of at least 28 proteins, 23 of which are predicted to be membrane proteins. Besides the major capsid protein, putative function can be assigned to 4 other components of the virion: two lectin proteins, a thioredoxin and a serine/threonine protein kinase.</p>
            </sec>
            <sec>
               <st>
                  <p>Conclusion</p>
               </st>
               <p>This study represents the first steps toward the identification of the protein components that make up the EhV-86 virion. Aside from the major capsid protein, whose function in the virion is well known and defined, the nature of the other proteins suggest roles involved with viral budding, caspase activation, signalling, anti-oxidation, virus adsorption and host range determination.</p>
            </sec>
         </sec>
      </abs>
   </fm>
   <bdy>
      <sec>
         <st>
            <p>Background</p>
         </st>
         <p><it>Emiliania huxleyi </it>is the most numerically abundant coccolithophore in the world's oceans and is well known for forming vast blooms that can cover up to 10,000 km<sup>2 </sup><abbrgrp><abbr bid="B1">1</abbr><abbr bid="B2">2</abbr></abbrgrp>. Viruses have been shown to be a major cause of <it>E. huxleyi </it>bloom termination <abbrgrp><abbr bid="B3">3</abbr><abbr bid="B4">4</abbr><abbr bid="B5">5</abbr></abbrgrp>.<it> Emiliania huxleyi </it>virus 86 (EhV-86) is the type species of the genus <it>Coccolithovirus </it>within the family <it>Phycodnaviridae </it><abbrgrp><abbr bid="B3">3</abbr></abbrgrp>. EhV-86 was originally isolated from a coccolithophore bloom off the coast of England in 1999 and is a large, double-stranded DNA (dsDNA) virus that infects the marine coccolithophorid <it>E. huxleyi </it><abbrgrp><abbr bid="B4">4</abbr></abbrgrp>. The fully sequenced 407,339 bp genome is predicted to encode 473 protein coding sequences (CDSs) and is the largest <it>Phycodnaviridae </it>sequenced to date <abbrgrp><abbr bid="B5">5</abbr></abbrgrp>. Of the 473 predicted CDSs just 66 are annotated with functional product predictions on the basis of sequence similarity or protein domain matches. With the completion of the EhV-86 genomic DNA sequence and its annotation our research has now focused on the functional analysis of the gene products. Essential to the functional analysis is the identification of the proteins associated with the virion particle. Due to the relative simplicity of virus proteomes, 1-DE followed by LC-MS/MS was selected for proteomic analysis to determine the protein composition of the EhV-86 virion.</p>
      </sec>
      <sec>
         <st>
            <p>Methods</p>
         </st>
         <p>Viral particles were purified from the lysate of an <it>E. huxleyi </it>1516 culture previously infected with EhV-86. Briefly, <it>E. huxleyi </it>strain 1516 was cultured in 10 litres of f/2 medium at 15&#176;C in a Sanyo MLR-350 incubator with 16 h: 8 h light-dark illumination <abbrgrp><abbr bid="B6">6</abbr></abbrgrp>. Exponentially growing (10 litres, 1.2 &#215; 10<sup>6 </sup>cells ml<sup>-1</sup>) cells were infected with 10 ml of fresh EhV-86 lysate as described previously <abbrgrp><abbr bid="B5">5</abbr></abbrgrp>. Once clearing of the host culture was observed (5 days later), the lysate was passed through a 0.2 &#956;m Supor membrane filter (Pall) and the filtrate concentrated by tangential flow filtration (Vivaflow200, Sartorius) to 50 ml. Virus particles were purified by CsCl gradient centrifugation (1.1 g/ml, 1.2 g/ml, 1.3 g/ml, 1.4 g/ml). CsCl-purified virus was dialysed against 30 mM Tris pH 7.4, 1 mM EDTA for 24 h and stored at 4&#176;C. Virion proteins were then precipitated overnight at -20&#176;C in 0.1 M ammonium acetate in methanol. Following centrifugation at 3 000 g for 10 mins, the pellet was washed in 80% 0.1 M ammonium acetate solution then again in 80% acetone. The protein pellet was desiccated to remove traces of acetone, then run on a 10% linear gradient 1-D SDS PAGE mini-gel and stained with colloidal coomassie.</p>
         <p>The next stage was the identification of proteins within the gel. Approximately 1 mm slices were cut successively from the whole length of each track, 16 in total. The whole track was excised in this way in order to identify as many proteins as possible, and not just those which stained strongly with colloidal coomassie. Proteins within the gel pieces were first reduced, carboxyamidomethylated, and then digested to peptides using trypsin on a MassPrepStation (Waters, Manchester, UK). The resulting peptides were applied to a LC-MS/MS. For LC-MS/MS, the reverse phase liquid chromatographic separation of peptides was achieved with a PepMap C18 reverse phase, 75 &#956;m i.d., 15-cm column (LC Packings) on a nanoAcquity LC system (Waters) attached to QTOF Premier (Waters) mass spectrometer. The MS/MS fragmentation data achieved was used to search the National Center for Biotechnology Information database using the MASCOT search engine <abbrgrp><abbr bid="B7">7</abbr></abbrgrp>. Probability-based MASCOT scores were used to evaluate identifications. Only matches with P &lt; 0.05 for random occurrence were considered significant. The data has been submitted to the PRIDE database under accession number 3182 <abbrgrp><abbr bid="B8">8</abbr></abbrgrp>. Functional and structural annotation was predicted using InterProScan <abbrgrp><abbr bid="B9">9</abbr><abbr bid="B10">10</abbr></abbrgrp>. Similarity searches were performed using BLASTP against nonredundant protein sequences <abbrgrp><abbr bid="B11">11</abbr><abbr bid="B12">12</abbr></abbrgrp>, and transmembrane domains were predicted using HMMTOP v2 <abbrgrp><abbr bid="B13">13</abbr></abbrgrp>.</p>
      </sec>
      <sec>
         <st>
            <p>Results and Discussion</p>
         </st>
         <p>An indeterminate number of faint protein gel bands were visible by SDS-PAGE in the 10 to 200 kDa range, which were dominated by two major bands at 60 kDa and 40 kDa (Figure <figr fid="F1">1</figr>). LC-MS analysis revealed that the virion of EhV-86 is composed of at least 28 proteins (Tables <tblr tid="T1">1</tblr> and <tblr tid="T2">2</tblr>). The 60 kDa band seen by SDS-PAGE (Figure <figr fid="F1">1</figr>) is likely to correspond to the major capsid protein (predicted weight of 59.9 kDa), the 40 kDa band is likely to be a composite of the protein products from ehv067, ehv100, ehv149, and ehv175 with predicted weights of 41.9, 40.0, 40.0, 40.6 kDa, respectively (Tables <tblr tid="T1">1</tblr> and <tblr tid="T2">2</tblr>).</p>
         <fig id="F1">
            <title>
               <p>Figure 1</p>
            </title>
            <caption>
               <p>SDS PAGE of EhV-86 virion proteins</p>
            </caption>
            <text>
               <p>
                  <b>SDS PAGE of EhV-86 virion proteins.</b>
               </p>
            </text>
            <graphic file="1477-5956-6-11-1"/>
         </fig>
         <tbl id="T1">
            <title>
               <p>Table 1</p>
            </title>
            <caption>
               <p>Proteins identified by LC-MS in purified EhV-86 virions.</p>
            </caption>
            <tblbdy cols="6">
               <r>
                  <c ca="left">
                     <p>TREMBL</p>
                  </c>
                  <c ca="left">
                     <p>Gene</p>
                  </c>
                  <c ca="center">
                     <p>Expression Profile<sup>a</sup></p>
                  </c>
                  <c ca="center">
                     <p>Number of peptides</p>
                  </c>
                  <c ca="center">
                     <p>MW<sup>b </sup>(kDa)</p>
                  </c>
                  <c ca="center">
                     <p>Mascot<sup>c</sup></p>
                  </c>
               </r>
               <r>
                  <c cspan="6">
                     <hr/>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>Q4A3B2</p>
                  </c>
                  <c ca="left">
                     <p>ehv015</p>
                  </c>
                  <c ca="center">
                     <p>2&#8211;4 h p.i.</p>
                  </c>
                  <c ca="center">
                     <p>1</p>
                  </c>
                  <c ca="center">
                     <p>14.6</p>
                  </c>
                  <c ca="center">
                     <p>79</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>Q4A399</p>
                  </c>
                  <c ca="left">
                     <p>ehv034</p>
                  </c>
                  <c ca="center">
                     <p>> 4 h p.i.</p>
                  </c>
                  <c ca="center">
                     <p>2</p>
                  </c>
                  <c ca="center">
                     <p>18.7</p>
                  </c>
                  <c ca="center">
                     <p>117</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>Q4A398</p>
                  </c>
                  <c ca="left">
                     <p>ehv035</p>
                  </c>
                  <c ca="center">
                     <p>1&#8211;2 h p.i.</p>
                  </c>
                  <c ca="center">
                     <p>16</p>
                  </c>
                  <c ca="center">
                     <p>141.4</p>
                  </c>
                  <c ca="center">
                     <p>600</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>Q4A397</p>
                  </c>
                  <c ca="left">
                     <p>ehv036</p>
                  </c>
                  <c ca="center">
                     <p>2&#8211;4 h p.i.</p>
                  </c>
                  <c ca="center">
                     <p>2</p>
                  </c>
                  <c ca="center">
                     <p>18.6</p>
                  </c>
                  <c ca="center">
                     <p>97</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>Q4A395</p>
                  </c>
                  <c ca="left">
                     <p>ehv038</p>
                  </c>
                  <c ca="center">
                     <p>2&#8211;4 h p.i.</p>
                  </c>
                  <c ca="center">
                     <p>1</p>
                  </c>
                  <c ca="center">
                     <p>12.5</p>
                  </c>
                  <c ca="center">
                     <p>48</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>Q4A378</p>
                  </c>
                  <c ca="left">
                     <p>ehv055</p>
                  </c>
                  <c ca="center">
                     <p>unknown</p>
                  </c>
                  <c ca="center">
                     <p>3</p>
                  </c>
                  <c ca="center">
                     <p>34.1</p>
                  </c>
                  <c ca="center">
                     <p>59</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>Q4A373</p>
                  </c>
                  <c ca="left">
                     <p>ehv060</p>
                  </c>
                  <c ca="center">
                     <p>> 4 h p.i.</p>
                  </c>
                  <c ca="center">
                     <p>1</p>
                  </c>
                  <c ca="center">
                     <p>212.2</p>
                  </c>
                  <c ca="center">
                     <p>207</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>Q4A366</p>
                  </c>
                  <c ca="left">
                     <p>ehv067</p>
                  </c>
                  <c ca="center">
                     <p>> 4 h p.i.</p>
                  </c>
                  <c ca="center">
                     <p>4</p>
                  </c>
                  <c ca="center">
                     <p>41.9</p>
                  </c>
                  <c ca="center">
                     <p>145</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>Q4A348</p>
                  </c>
                  <c ca="left">
                     <p>ehv085</p>
                  </c>
                  <c ca="center">
                     <p>2&#8211;4 h p.i.</p>
                  </c>
                  <c ca="center">
                     <p>22</p>
                  </c>
                  <c ca="center">
                     <p>59.9</p>
                  </c>
                  <c ca="center">
                     <p>1224</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>Q4A333</p>
                  </c>
                  <c ca="left">
                     <p>ehv100</p>
                  </c>
                  <c ca="center">
                     <p>2&#8211;4 h p.i.</p>
                  </c>
                  <c ca="center">
                     <p>2</p>
                  </c>
                  <c ca="center">
                     <p>40.0</p>
                  </c>
                  <c ca="center">
                     <p>208</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>Q4A2Y5</p>
                  </c>
                  <c ca="left">
                     <p>ehv149</p>
                  </c>
                  <c ca="center">
                     <p>1&#8211;2 h p.i.</p>
                  </c>
                  <c ca="center">
                     <p>8</p>
                  </c>
                  <c ca="center">
                     <p>40.0</p>
                  </c>
                  <c ca="center">
                     <p>285</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>Q4A2W6</p>
                  </c>
                  <c ca="left">
                     <p>ehv168</p>
                  </c>
                  <c ca="center">
                     <p>> 4 h p.i.</p>
                  </c>
                  <c ca="center">
                     <p>4</p>
                  </c>
                  <c ca="center">
                     <p>18.6</p>
                  </c>
                  <c ca="center">
                     <p>239</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>Q4A2V9</p>
                  </c>
                  <c ca="left">
                     <p>ehv175</p>
                  </c>
                  <c ca="center">
                     <p>> 4 h p.i.</p>
                  </c>
                  <c ca="center">
                     <p>2</p>
                  </c>
                  <c ca="center">
                     <p>40.6</p>
                  </c>
                  <c ca="center">
                     <p>59</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>Q4A2V2</p>
                  </c>
                  <c ca="left">
                     <p>ehv182</p>
                  </c>
                  <c ca="center">
                     <p>> 4 h p.i.</p>
                  </c>
                  <c ca="center">
                     <p>4</p>
                  </c>
                  <c ca="center">
                     <p>22.7</p>
                  </c>
                  <c ca="center">
                     <p>248</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>Q4A2U4</p>
                  </c>
                  <c ca="left">
                     <p>ehv189</p>
                  </c>
                  <c ca="center">
                     <p>unknown</p>
                  </c>
                  <c ca="center">
                     <p>2</p>
                  </c>
                  <c ca="center">
                     <p>45.4</p>
                  </c>
                  <c ca="center">
                     <p>109</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>Q4A2U2</p>
                  </c>
                  <c ca="left">
                     <p>ehv191</p>
                  </c>
                  <c ca="center">
                     <p>1&#8211;2 h p.i.</p>
                  </c>
                  <c ca="center">
                     <p>1</p>
                  </c>
                  <c ca="center">
                     <p>93.8</p>
                  </c>
                  <c ca="center">
                     <p>46</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>Q4A2T8</p>
                  </c>
                  <c ca="left">
                     <p>ehv195</p>
                  </c>
                  <c ca="center">
                     <p>> 4 h p.i.</p>
                  </c>
                  <c ca="center">
                     <p>1</p>
                  </c>
                  <c ca="center">
                     <p>22.1</p>
                  </c>
                  <c ca="center">
                     <p>57</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>Q4A2T3</p>
                  </c>
                  <c ca="left">
                     <p>ehv200</p>
                  </c>
                  <c ca="center">
                     <p>> 4 h p.i.</p>
                  </c>
                  <c ca="center">
                     <p>3</p>
                  </c>
                  <c ca="center">
                     <p>34.1</p>
                  </c>
                  <c ca="center">
                     <p>157</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>Q4A2N2</p>
                  </c>
                  <c ca="left">
                     <p>ehv250</p>
                  </c>
                  <c ca="center">
                     <p>> 4 h p.i.</p>
                  </c>
                  <c ca="center">
                     <p>1</p>
                  </c>
                  <c ca="center">
                     <p>11.9</p>
                  </c>
                  <c ca="center">
                     <p>100</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>Q4A2H9</p>
                  </c>
                  <c ca="left">
                     <p>ehv301</p>
                  </c>
                  <c ca="center">
                     <p>> 4 h p.i.</p>
                  </c>
                  <c ca="center">
                     <p>2</p>
                  </c>
                  <c ca="center">
                     <p>32.0</p>
                  </c>
                  <c ca="center">
                     <p>139</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>Q4A2F4</p>
                  </c>
                  <c ca="left">
                     <p>ehv325</p>
                  </c>
                  <c ca="center">
                     <p>> 4 h p.i.</p>
                  </c>
                  <c ca="center">
                     <p>1</p>
                  </c>
                  <c ca="center">
                     <p>15.8</p>
                  </c>
                  <c ca="center">
                     <p>43</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>Q4A2E6</p>
                  </c>
                  <c ca="left">
                     <p>ehv333</p>
                  </c>
                  <c ca="center">
                     <p>Unknown</p>
                  </c>
                  <c ca="center">
                     <p>1</p>
                  </c>
                  <c ca="center">
                     <p>13.5</p>
                  </c>
                  <c ca="center">
                     <p>35</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>Q4A2D9</p>
                  </c>
                  <c ca="left">
                     <p>ehv340</p>
                  </c>
                  <c ca="center">
                     <p>> 4 h p.i.</p>
                  </c>
                  <c ca="center">
                     <p>1</p>
                  </c>
                  <c ca="center">
                     <p>14.4</p>
                  </c>
                  <c ca="center">
                     <p>48</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>Q4A2C3</p>
                  </c>
                  <c ca="left">
                     <p>ehv356</p>
                  </c>
                  <c ca="center">
                     <p>Unknown</p>
                  </c>
                  <c ca="center">
                     <p>2</p>
                  </c>
                  <c ca="center">
                     <p>81.0</p>
                  </c>
                  <c ca="center">
                     <p>39</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>Q4A2C1</p>
                  </c>
                  <c ca="left">
                     <p>ehv358</p>
                  </c>
                  <c ca="center">
                     <p>> 4 h p.i.</p>
                  </c>
                  <c ca="center">
                     <p>1</p>
                  </c>
                  <c ca="center">
                     <p>17.2</p>
                  </c>
                  <c ca="center">
                     <p>45</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>Q4A237</p>
                  </c>
                  <c ca="left">
                     <p>ehv442</p>
                  </c>
                  <c ca="center">
                     <p>> 4 h p.i.</p>
                  </c>
                  <c ca="center">
                     <p>1</p>
                  </c>
                  <c ca="center">
                     <p>19.4</p>
                  </c>
                  <c ca="center">
                     <p>58</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>Q4A225</p>
                  </c>
                  <c ca="left">
                     <p>ehv454</p>
                  </c>
                  <c ca="center">
                     <p>2&#8211;4 h p.i.</p>
                  </c>
                  <c ca="center">
                     <p>3</p>
                  </c>
                  <c ca="center">
                     <p>74.4</p>
                  </c>
                  <c ca="center">
                     <p>119</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>Q4A218</p>
                  </c>
                  <c ca="left">
                     <p>ehv461</p>
                  </c>
                  <c ca="center">
                     <p>1&#8211;2 h p.i.</p>
                  </c>
                  <c ca="center">
                     <p>4</p>
                  </c>
                  <c ca="center">
                     <p>32.9</p>
                  </c>
                  <c ca="center">
                     <p>36</p>
                  </c>
               </r>
            </tblbdy>
            <tblfn>
               <p><sup>a </sup>Data from Allen <it>et al</it>., 2006; p.i. indicates the time post infection when the transcript is first seen [25]. <sup>b</sup>Predicted MW. <sup>c</sup>The highest score is shown in the case of protein identification in multiple bands.</p>
            </tblfn>
         </tbl>
         <tbl id="T2">
            <title>
               <p>Table 2</p>
            </title>
            <caption>
               <p>Unique peptides used in the identification of proteins from the EhV-86 virion.</p>
            </caption>
            <tblbdy cols="2">
               <r>
                  <c ca="left">
                     <p>
                        <b>Gene</b>
                     </p>
                  </c>
                  <c ca="left">
                     <p>
                        <b>Peptides used for identification of protein product</b>
                     </p>
                  </c>
               </r>
               <r>
                  <c cspan="2">
                     <hr/>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv015</p>
                  </c>
                  <c ca="left">
                     <p>RDIILDPNASPSDKR</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv034</p>
                  </c>
                  <c ca="left">
                     <p>KCIAPDYNKN, KVLNETVSGYFRR</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv035</p>
                  </c>
                  <c ca="left">
                     <p>KDRPLISENGRY, KDSEIEDLEEQNNSLDRD, KEGYDQNFIGVPSYAVRD, KGIIGVALLEGKG, KIPYVYLNPYLKR, KITAPTAALAAEAAKL, KLAGVYGCGSKT, KLATTVASDIETRK, KNILSGDLEKE, KNYDDSVFFKD, KQIETITAELEPLAEKD, KQMEQLQFEKD, KTSTDLANCTTKV, KVGGPYTVISRN, RATAQSEHVAQLLSIETNKN, RLSNLGVLSTNNQILNKN,</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv036</p>
                  </c>
                  <c ca="left">
                     <p>KESEADLAEAKR, RELGEATDDLGDAKK</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv038</p>
                  </c>
                  <c ca="left">
                     <p>KTTLSDITAEIADKR</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv055</p>
                  </c>
                  <c ca="left">
                     <p>KDDVDAWKE, KDDVDAWKEESFVMRA, KTDFNSAVVKS</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv060</p>
                  </c>
                  <c ca="left">
                     <p>KIDSWEPGELAELYVDSTRV</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv067</p>
                  </c>
                  <c ca="left">
                     <p>KELNLVLPPGTKG, KLAVIEEIDNKL, KLIIPAETARH, RYMTPLDVARE</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv085</p>
                  </c>
                  <c ca="left">
                     <p>KANKDAGDHFNFSGIGGRD, KDAGDHFNFSGIGGRD KDAGDHFNFSGIGGRDPVVSAELLFNNTARV, KEQLIAEAKN, KFTNGLAGLLYSN-, KIVLPGLKV, KVGGATIDTIWSELLFAMEELMGRA, KYNAAPLPVAAQMQSTEMPDFDYAYWTEAIGFHLIKR, RASLECTYVHLEAAERD, RDALTANAGTQLIVQHQAHLQQVSSNNVTARL, RDPVVSAELLFNNTARV, RLDSVELALTLQDDFGAAHDANSELFVFARS, RLTETIGRT, RNVPISDDHLRA, RQEQILYVPLPWYFTKH, RQGDLLSWMYLKI, RQGDLLSWMYLKI, RRLTETIGRT, RRPTELMKA, RRPTELMKA, RSNLVVLHAERN, RVTQKPAVWWRA</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv100</p>
                  </c>
                  <c ca="left">
                     <p>KTTPAIGLGPPDKY, KGTCIGNLTQCTTEKG</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv149</p>
                  </c>
                  <c ca="left">
                     <p>KCIPDLATICTGKL, KKYDCAPGTKV, KLEPGADNNCVIKA, KLNNVSTGAKK, KVGPLGEKC, KYDCAPGTKV, RAAAAWAATRG, RGMAGSAAGATSSAAKS</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv168</p>
                  </c>
                  <c ca="left">
                     <p>KNSALMEMVKS, KSTMGAGELEVARQ, KWTGAAAAGAAAPSAADVIYKR, RGVYGPQPAGSDSSTGKT</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv175</p>
                  </c>
                  <c ca="left">
                     <p>RRPPNILVKM, RYFEDIFNNPRN</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv182</p>
                  </c>
                  <c ca="left">
                     <p>KEISDPEIVDLKY, KSTCMFEADRS, KYDEESSSPARK, RFVVGDFIINNQGKL</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv189</p>
                  </c>
                  <c ca="left">
                     <p>KVVDSLYDFRI, RYNAQQSIRD</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv191</p>
                  </c>
                  <c ca="left">
                     <p>KQNLGQSDGNLLRA</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv195</p>
                  </c>
                  <c ca="left">
                     <p>RSNNQYNVQRR</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv200</p>
                  </c>
                  <c ca="left">
                     <p>KSNGYDDNFVGVNKS, KVMAVSATGTTARV, RVNVSPYWPRN</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv250</p>
                  </c>
                  <c ca="left">
                     <p>KSFEDAANTPGYLSARS</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv301</p>
                  </c>
                  <c ca="left">
                     <p>RSMNPNDIRT, RSNEVNDTMIARS</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv325</p>
                  </c>
                  <c ca="left">
                     <p>KEQPNTVSGERV</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv333</p>
                  </c>
                  <c ca="left">
                     <p>KGYDVAAVQRI</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv340</p>
                  </c>
                  <c ca="left">
                     <p>KAIGEGMEPGMIRA</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv356</p>
                  </c>
                  <c ca="left">
                     <p>RGQTDPSQNPVVDTRF, KNPSIIGAAEKY</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv358</p>
                  </c>
                  <c ca="left">
                     <p>KSADELNTLVKE</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv442</p>
                  </c>
                  <c ca="left">
                     <p>KYANGSNVTLYYDPKN</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv454</p>
                  </c>
                  <c ca="left">
                     <p>KIPTATVTTRQ, RWSGDYLEIKK, KSAVTSITLLTDLEQVRV</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv461</p>
                  </c>
                  <c ca="left">
                     <p>KTNAIELRR, KVDVYSLSPKN, RLTEELRF, RVGAHGPVEIRV</p>
                  </c>
               </r>
            </tblbdy>
         </tbl>
         <p>Virus particles are essentially composed of structural proteins and nucleic acids. Only one protein identified in this study has a known function associated with it. The role of the major capsid protein is well defined in viral systems and it typically comprises approximately 40% of the total virion protein mass in phycodnaviruses <abbrgrp><abbr bid="B14">14</abbr></abbrgrp>. Major capsid proteins consist of two consecutive "jelly roll" domains (antiparallel &#946;-barrels) and are a conserved component of the capsid structures in ssRNA, dsRNA, ssDNA and dsDNA viruses <abbrgrp><abbr bid="B14">14</abbr><abbr bid="B15">15</abbr></abbrgrp>.</p>
         <p>It is surprising that of the remaining 27 proteins identified in this study, 23 are predicted to be membrane proteins (Table <tblr tid="T3">3</tblr>). It is possible that these proteins are associated with an internal membrane, akin to that observed in other <it>Phycodnaviridae </it><abbrgrp><abbr bid="B16">16</abbr><abbr bid="B17">17</abbr></abbrgrp>. However, electron microscopy imagery and flow cytometry data has shown that virus release occurs via budding at the host membrane (unpublished). This would suggest that virion particles may be coated in a lipid-protein membrane as they are released from infected cells. One or more of the membrane proteins identified here may be responsible for coordinating this viral budding through the formation of lipid rafts at the plasma membrane. This hypothesis is further enhanced by the previous identification of a sphingolipid biosynthesis pathway in the virus genome <abbrgrp><abbr bid="B5">5</abbr><abbr bid="B18">18</abbr></abbrgrp>. Sphingolipids are essential structural components of membranes and are found to be enriched in lipid rafts <abbrgrp><abbr bid="B18">18</abbr></abbrgrp>. An enveloped virus release mechanism has been shown to occur in the retroviruses, paramyxoviruses, orthomyxoviruses and filoviruses <abbrgrp><abbr bid="B19">19</abbr></abbrgrp>. Indeed, this type of mechanism has also been shown to occur with poxviruses, a virus family distantly related to the coccolithoviruses. Hitherto, phycodnaviruses were not thought to be associated with an outer membrane, but the identification of these putative membrane proteins in the EhV-86 virion and the budding release mechanism suggests this is a distinct possibility for the coccolithoviruses.</p>
         <tbl id="T3">
            <title>
               <p>Table 3</p>
            </title>
            <caption>
               <p>Analysis of proteins identified in the EhV-86 virion.</p>
            </caption>
            <tblbdy cols="5">
               <r>
                  <c>
                     <p/>
                  </c>
                  <c cspan="4" ca="center">
                     <p>Protein Analysis</p>
                  </c>
               </r>
               <r>
                  <c cspan="5">
                     <hr/>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>Gene Number</p>
                  </c>
                  <c ca="left">
                     <p>Top Blast Hit<sup>a</sup></p>
                  </c>
                  <c ca="left">
                     <p>Blast Score<sup>a</sup></p>
                  </c>
                  <c ca="left">
                     <p>TMs<sup>b</sup></p>
                  </c>
                  <c ca="left">
                     <p>InterProScan Results<sup>c</sup></p>
                  </c>
               </r>
               <r>
                  <c cspan="5">
                     <hr/>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv015</p>
                  </c>
                  <c ca="left">
                     <p>hypothetical protein, <it>Trichomonas vaginalis </it>G3.</p>
                  </c>
                  <c ca="left">
                     <p>0.009</p>
                  </c>
                  <c ca="left">
                     <p>1</p>
                  </c>
                  <c ca="left">
                     <p>No hits reported.</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv034</p>
                  </c>
                  <c ca="left">
                     <p>predicted protein, <it>Ostreococcus lucimarinus</it></p>
                  </c>
                  <c ca="left">
                     <p>0.016</p>
                  </c>
                  <c ca="left">
                     <p>1</p>
                  </c>
                  <c ca="left">
                     <p>No hits reported.</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv035</p>
                  </c>
                  <c ca="left">
                     <p>similar to SMC2 protein, <it>Bos taurus</it></p>
                  </c>
                  <c ca="left">
                     <p>0.058</p>
                  </c>
                  <c ca="left">
                     <p>2</p>
                  </c>
                  <c ca="left">
                     <p>No hits reported.</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv036</p>
                  </c>
                  <c ca="left">
                     <p>HlyD family secretion protein, <it>Agrobacterium tumefaciens</it></p>
                  </c>
                  <c ca="left">
                     <p>0.004</p>
                  </c>
                  <c ca="left">
                     <p>2</p>
                  </c>
                  <c ca="left">
                     <p>No hits reported.</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv038</p>
                  </c>
                  <c ca="left">
                     <p>hypothetical protein, <it>Bos taurus</it></p>
                  </c>
                  <c ca="left">
                     <p>0.32</p>
                  </c>
                  <c ca="left">
                     <p>1</p>
                  </c>
                  <c ca="left">
                     <p>No hits reported.</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv055</p>
                  </c>
                  <c ca="left">
                     <p>hypothetical protein, <it>Methanothermobacter thermautotrophicus</it></p>
                  </c>
                  <c ca="left">
                     <p>5e<sup>-06</sup></p>
                  </c>
                  <c ca="left">
                     <p>6</p>
                  </c>
                  <c ca="left">
                     <p>No hits reported.</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv060</p>
                  </c>
                  <c ca="left">
                     <p>No significant match</p>
                  </c>
                  <c ca="left">
                     <p>n/a</p>
                  </c>
                  <c ca="left">
                     <p>1</p>
                  </c>
                  <c ca="left">
                     <p>C type lectin 2 domain</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv067</p>
                  </c>
                  <c ca="left">
                     <p>Hypothetical protein, <it>Giardia lamblia</it></p>
                  </c>
                  <c ca="left">
                     <p>1.4</p>
                  </c>
                  <c ca="left">
                     <p>0</p>
                  </c>
                  <c ca="left">
                     <p>No hits reported.</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv085</p>
                  </c>
                  <c ca="left">
                     <p>major capsid protein, Heterosigma akashiwo virus 01</p>
                  </c>
                  <c ca="left">
                     <p>7e<sup>-39</sup></p>
                  </c>
                  <c ca="left">
                     <p>0</p>
                  </c>
                  <c ca="left">
                     <p>Capsid domain (iridovirus like)</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv100</p>
                  </c>
                  <c ca="left">
                     <p>predicted protein, <it>Nematostella vectensis</it></p>
                  </c>
                  <c ca="left">
                     <p>5e<sup>-10</sup></p>
                  </c>
                  <c ca="left">
                     <p>2</p>
                  </c>
                  <c ca="left">
                     <p>No hits reported.</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv149</p>
                  </c>
                  <c ca="left">
                     <p>hypothetical protein, <it>Aedes aegypti</it></p>
                  </c>
                  <c ca="left">
                     <p>0.43</p>
                  </c>
                  <c ca="left">
                     <p>2</p>
                  </c>
                  <c ca="left">
                     <p>C type lectin 1 domain</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv168</p>
                  </c>
                  <c ca="left">
                     <p>hypothetical protein, <it>Novosphingobium aromaticivorans</it></p>
                  </c>
                  <c ca="left">
                     <p>2.4</p>
                  </c>
                  <c ca="left">
                     <p>1</p>
                  </c>
                  <c ca="left">
                     <p>No hits reported.</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv175</p>
                  </c>
                  <c ca="left">
                     <p>Putative serine/threonine protein kinase, <it>Populus tomentosa</it></p>
                  </c>
                  <c ca="left">
                     <p>0.66</p>
                  </c>
                  <c ca="left">
                     <p>0</p>
                  </c>
                  <c ca="left">
                     <p>Protein Kinase</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv182</p>
                  </c>
                  <c ca="left">
                     <p>diaminopimelate decarboxylase, <it>Streptococcus pneumoniae</it></p>
                  </c>
                  <c ca="left">
                     <p>0.48</p>
                  </c>
                  <c ca="left">
                     <p>1</p>
                  </c>
                  <c ca="left">
                     <p>No hits reported.</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv189</p>
                  </c>
                  <c ca="left">
                     <p>pol-like protein, <it>Nasonia vitripennis</it></p>
                  </c>
                  <c ca="left">
                     <p>2.0</p>
                  </c>
                  <c ca="left">
                     <p>0</p>
                  </c>
                  <c ca="left">
                     <p>No hits reported.</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv191</p>
                  </c>
                  <c ca="left">
                     <p>No significant match</p>
                  </c>
                  <c ca="left">
                     <p>n/a</p>
                  </c>
                  <c ca="left">
                     <p>1</p>
                  </c>
                  <c ca="left">
                     <p>Proline rich extensin signature</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv195</p>
                  </c>
                  <c ca="left">
                     <p>hypothetical protein, <it>Salinispora arenicola</it></p>
                  </c>
                  <c ca="left">
                     <p>0.27</p>
                  </c>
                  <c ca="left">
                     <p>2</p>
                  </c>
                  <c ca="left">
                     <p>No hits reported.</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv200</p>
                  </c>
                  <c ca="left">
                     <p>hypothetical protein, <it>Bacillus sp</it>.</p>
                  </c>
                  <c ca="left">
                     <p>0.23</p>
                  </c>
                  <c ca="left">
                     <p>1</p>
                  </c>
                  <c ca="left">
                     <p>No hits reported.</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv250</p>
                  </c>
                  <c ca="left">
                     <p>GCN5-related N-acetyltransferase, <it>Rhodopseudomonas palustris</it></p>
                  </c>
                  <c ca="left">
                     <p>9.6</p>
                  </c>
                  <c ca="left">
                     <p>1</p>
                  </c>
                  <c ca="left">
                     <p>No hits reported.</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv301</p>
                  </c>
                  <c ca="left">
                     <p>NB-ARC domain containing protein, <it>Oryza sativa</it></p>
                  </c>
                  <c ca="left">
                     <p>0.31</p>
                  </c>
                  <c ca="left">
                     <p>0</p>
                  </c>
                  <c ca="left">
                     <p>No hits reported.</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv325</p>
                  </c>
                  <c ca="left">
                     <p>envelope glycoprotein, Simian immunodeficiency virus</p>
                  </c>
                  <c ca="left">
                     <p>1.1</p>
                  </c>
                  <c ca="left">
                     <p>1</p>
                  </c>
                  <c ca="left">
                     <p>No hits reported.</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv333</p>
                  </c>
                  <c ca="left">
                     <p>CRISPR-associated protein, Cse1 family, <it>Pseudomonas mendocina</it></p>
                  </c>
                  <c ca="left">
                     <p>0.35</p>
                  </c>
                  <c ca="left">
                     <p>2</p>
                  </c>
                  <c ca="left">
                     <p>No hits reported</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv340</p>
                  </c>
                  <c ca="left">
                     <p>Putative fimbrial associated sortase-like protein, <it>Corynebacterium diphtheriae</it></p>
                  </c>
                  <c ca="left">
                     <p>0.42</p>
                  </c>
                  <c ca="left">
                     <p>1</p>
                  </c>
                  <c ca="left">
                     <p>No hits reported.</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv356</p>
                  </c>
                  <c ca="left">
                     <p>No match</p>
                  </c>
                  <c ca="left">
                     <p>n/a</p>
                  </c>
                  <c ca="left">
                     <p>1</p>
                  </c>
                  <c ca="left">
                     <p>No hits reported</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv358</p>
                  </c>
                  <c ca="left">
                     <p>hypothetical protein, <it>Paramecium tetraurelia</it></p>
                  </c>
                  <c ca="left">
                     <p>2e<sup>-08</sup></p>
                  </c>
                  <c ca="left">
                     <p>1</p>
                  </c>
                  <c ca="left">
                     <p>Thioredoxin domain</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv442</p>
                  </c>
                  <c ca="left">
                     <p>conserved hypothetical protein, <it>Stigmatella aurantiaca</it></p>
                  </c>
                  <c ca="left">
                     <p>0.008</p>
                  </c>
                  <c ca="left">
                     <p>2</p>
                  </c>
                  <c ca="left">
                     <p>No hits reported.</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv454</p>
                  </c>
                  <c ca="left">
                     <p>hemocyanin isoform 1, <it>Nucula nucleus</it></p>
                  </c>
                  <c ca="left">
                     <p>2.2</p>
                  </c>
                  <c ca="left">
                     <p>2</p>
                  </c>
                  <c ca="left">
                     <p>No hits reported.</p>
                  </c>
               </r>
               <r>
                  <c ca="left">
                     <p>ehv461</p>
                  </c>
                  <c ca="left">
                     <p>Fatty acid/phospholipid synthesis protein, <it>Herminiimonas arsenicoxydans</it></p>
                  </c>
                  <c ca="left">
                     <p>2.6</p>
                  </c>
                  <c ca="left">
                     <p>1</p>
                  </c>
                  <c ca="left">
                     <p>No hits reported</p>
                  </c>
               </r>
            </tblbdy>
            <tblfn>
               <p><sup>a</sup>BLASTP analysis [12] against nonredundant protein sequences performed on 12<sup>th </sup>December 2007. <sup>b</sup>Transmembrane (TM) domains predicted by HMMTOP v2.0. <sup>c</sup>Functional and structure predicted by InterProScan [10].</p>
            </tblfn>
         </tbl>
         <p>Despite intensive database interrogation, no putative function can be assigned to 23 of the 28 proteins identified in this study (Table <tblr tid="T3">3</tblr>). Besides the major capsid protein, putative function can be assigned to 4 proteins: two lectin proteins, a thioredoxin and a serine/threonine protein kinase. Lectin proteins are well known for their specific and reversible binding to carbohydrate moieties and may function as a binding site during virus adsorption to the host cell. The presence of a putative thioredoxin protein is intriguing since their role as antioxidants is well documented <abbrgrp><abbr bid="B20">20</abbr></abbrgrp>, particularly since EhV-86 virions have been shown to be sensitive to reactive oxygen species <abbrgrp><abbr bid="B21">21</abbr></abbrgrp>. Indeed, elevated levels of cellular reactive oxygen species have been shown to be present in the latter stage of infection, suggesting the role of the thioredoxin protein may be to prevent damage during virion assembly <abbrgrp><abbr bid="B22">22</abbr></abbrgrp>. The protein kinase is likely to be involved in an as yet unidentified signalling pathway.</p>
         <p>No known components of transcriptional machinery, DNA repair or modification were detected in this study, despite being encoded on the viral genome. Several factors may account for the lack of data for these proteins including the relative abundance, size and hydrophobicity of the proteins. Other related viruses from the Nucleocytoplasmic Large DNA Virus (NCLDV) family such as the mimivirus and Vaccinia virus virions have been shown to contain 114 and 75 proteins respectively, so it is likely that, further and more extensive characterisation will reveal a larger number of proteins in the EhV-86 virion <abbrgrp><abbr bid="B23">23</abbr><abbr bid="B24">24</abbr><abbr bid="B25">25</abbr></abbrgrp>.</p>
         <p>Previous work has shown that 39 virus gene transcripts can be detected 1 hour into infection, a further 194 two hours post infection, and a further 71 at 4 hours post infection <abbrgrp><abbr bid="B25">25</abbr></abbrgrp>. Interestingly, 14 of the 28 proteins identified here fail to be expressed even at 4 hours post infection (see Table <tblr tid="T1">1</tblr>, genes expressed > 4 h post infection), suggesting that the majority of virion construction and assembly occurs later than 4 hours post infection. This would make sense if they are packaged into the capsid, since their genes are probably expressed last.</p>
         <p>Intriguingly, six proteins (EHV301, EHV325, EHV333, EHV340, EHV356 and EHV358) have been detected in the virion whose genes are located in a 100 kbp region of unknown origin or function <abbrgrp><abbr bid="B26">26</abbr><abbr bid="B27">27</abbr></abbrgrp>. Many of the genes in this region (but none of these six) are associated with a novel promoter element and are the only genes expressed during the first hour of infection <abbrgrp><abbr bid="B25">25</abbr></abbrgrp>. Transcriptional work has shown that the novel promoter associated genes are among the most highly expressed during infection, however not one of their gene products has been identified in the virion proteome in this study <abbrgrp><abbr bid="B5">5</abbr><abbr bid="B26">26</abbr></abbrgrp>. Of particular interest is the presence of a caspase cleavage site (YVAD) in EHV325. Host caspase activity (induced by coccolithoviruses upon infection) has recently been postulated to play a fundamental role in the viral replication strategy <abbrgrp><abbr bid="B28">28</abbr></abbrgrp>. The cleavage of EHV325 by an activated host caspase-like protease, prior to its incorporation as a mature protein into the virion, may account for delay in virus infection observed when caspase function is inhibited in <it>E. huxleyi</it>. Caspases are responsible for the initiation and execution of programmed cell death (PCD), a process which is also thought to be affected by ceramide <abbrgrp><abbr bid="B28">28</abbr><abbr bid="B29">29</abbr></abbrgrp>. Since the virus genome contains gene homologues for an almost complete biosynthetic pathway for ceramide production, it is clear PCD may have some important role to play during infection. It is speculative to suggest that EHV325, in its newly identified role as a virion component, may be involved in this process.</p>
         <p>There are 4 proteins identified whose genes are located at a distinct loci of the EhV-86 genome: EHV034, EHV035, EHV036 and EHV038. Although no known function has been determined for these proteins, their presence in the virion particle is intriguing since a microarray based genome wide survey has suggested that all four genes are either absent or their sequence is sufficiently divergent to cause a negative hybridisation in two Norwegian coccolithovirus strains <abbrgrp><abbr bid="B30">30</abbr></abbrgrp>. Furthermore, ehv034 and ehv301 were found to be absent (or their sequence sufficiently divergent) in nine and seven of the twelve strains tested, respectively. The presence, absence or divergence of the products of these genes in virions may account for the variability in host range observed for different coccolithovirus strains.</p>
      </sec>
      <sec>
         <st>
            <p>Conclusion</p>
         </st>
         <p>This study represents the first steps toward the identification of the protein components that make up the EhV-86 virion. Hitherto, only one virus protein (the major capsid protein) has been confirmed as part of the virion structure. Here, we have used a simple approach to determine that the EhV-86 virion is composed of at least 28 different proteins. Aside from the major capsid protein, whose function in the virion is well known and defined, the nature of the other proteins suggest roles involved with viral budding, the caspase pathway, signalling, anti-oxidation, virus adsorption and host range determination.</p>
      </sec>
      <sec>
         <st>
            <p>Competing interests</p>
         </st>
         <p>The author(s) declare that they have no competing interests.</p>
      </sec>
      <sec>
         <st>
            <p>Authors' contributions</p>
         </st>
         <p>MJA conceived of the study, designed the study, carried out the virus purification and protein preparation, analysed the data and drafted the manuscript. JAH carried out the SDS-PAGE and LC/MS, and analysed the data. KSL helped draft the manuscript. WHW conceived of the study, participated in its design and helped to draft the manuscript. All authors read and approved the final manuscript.</p>
      </sec>
   </bdy>
   <bm>
      <ack>
         <sec>
            <st>
               <p>Acknowledgements</p>
            </st>
            <p>This research was supported by grants awarded to WHW from the Natural Environment Research Council (NERC) Environmental Genomics thematic program (ref. NE/A509332/1 and NE/D001455/1) and from Marine Genomics Europe, through framework programme FP6 of the European Commission. We would like to thank Henning Hermjakob and Jean-Michel Claverie for commenting on the manuscript and the PRIDE Team for assistance with the data submission.</p>
         </sec>
      </ack>
      <refgrp>
         <bibl id="B1">
            <title>
               <p>A Model System Approach to Biological Climate Forcing &#8211; the Example of <it>Emiliania huxleyi</it></p>
            </title>
            <aug>
               <au>
                  <snm>Westbroek</snm>
                  <fnm>P</fnm>
               </au>
               <au>
                  <snm>Brown</snm>
                  <fnm>CW</fnm>
               </au>
               <au>
                  <snm>Vanbleijswijk</snm>
                  <fnm>J</fnm>
               </au>
               <au>
                  <snm>Brownlee</snm>
                  <fnm>C</fnm>
               </au>
               <au>
                  <snm>Brummer</snm>
                  <fnm>GJ</fnm>
               </au>
               <au>
                  <snm>Conte</snm>
                  <fnm>M</fnm>
               </au>
               <au>
                  <snm>Egge</snm>
                  <fnm>J</fnm>
               </au>
               <au>
                  <snm>Fernandez</snm>
                  <fnm>E</fnm>
               </au>
               <au>
                  <snm>Jordan</snm>
                  <fnm>R</fnm>
               </au>
               <au>
                  <snm>Knappertsbusch</snm>
                  <fnm>M</fnm>
               </au>
               <etal/>
            </aug>
            <source>Global and Planetary Change</source>
            <pubdate>1993</pubdate>
            <volume>8</volume>
            <fpage>27</fpage>
            <lpage>46</lpage>
            <xrefbib>
               <pubid idtype="doi">10.1016/0921-8181(93)90061-R</pubid>
            </xrefbib>
         </bibl>
         <bibl id="B2">
            <title>
               <p><it>Emiliania huxleyi </it>as a key to biosphere-geoshere interactions</p>
            </title>
            <aug>
               <au>
                  <snm>Westbroek</snm>
                  <fnm>P</fnm>
               </au>
               <au>
                  <snm>vanHinte</snm>
                  <fnm>JE</fnm>
               </au>
               <au>
                  <snm>Brummer</snm>
                  <fnm>GJ</fnm>
               </au>
               <au>
                  <snm>Veldhuis</snm>
                  <fnm>M</fnm>
               </au>
               <au>
                  <snm>Brownlee</snm>
                  <fnm>C</fnm>
               </au>
               <au>
                  <snm>Green</snm>
                  <fnm>JC</fnm>
               </au>
               <au>
                  <snm>Harris</snm>
                  <fnm>R</fnm>
               </au>
               <au>
                  <snm>Heimdal</snm>
                  <fnm>BR</fnm>
               </au>
            </aug>
            <source>The Haptophyte Algae</source>
            <publisher>Oxford: Clarendon Press</publisher>
            <editor>Green JC, Leadbeater BSC</editor>
            <pubdate>1994</pubdate>
            <volume>51</volume>
            <fpage>321</fpage>
            <lpage>334</lpage>
         </bibl>
         <bibl id="B3">
            <title>
               <p>Coccolithovirus (Phycodnaviridae): Characterisation of a new large dsDNA algal virus that infects Emiliania huxleyi</p>
            </title>
            <aug>
               <au>
                  <snm>Schroeder</snm>
                  <fnm>DC</fnm>
               </au>
               <au>
                  <snm>Oke</snm>
                  <fnm>J</fnm>
               </au>
               <au>
                  <snm>Malin</snm>
                  <fnm>G</fnm>
               </au>
               <au>
                  <snm>Wilson</snm>
                  <fnm>WH</fnm>
               </au>
            </aug>
            <source>Archives of Virology</source>
            <pubdate>2002</pubdate>
            <volume>147</volume>
            <fpage>1685</fpage>
            <lpage>1698</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1007/s00705-002-0841-3</pubid>
                  <pubid idtype="pmpid" link="fulltext">12209309</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B4">
            <title>
               <p>Family: Phycodnaviridae</p>
            </title>
            <aug>
               <au>
                  <snm>Wilson</snm>
                  <fnm>WH</fnm>
               </au>
               <au>
                  <snm>Van Etten</snm>
                  <fnm>JL</fnm>
               </au>
               <au>
                  <snm>Schroeder</snm>
                  <fnm>DS</fnm>
               </au>
               <au>
                  <snm>Nagasaki</snm>
                  <fnm>K</fnm>
               </au>
               <au>
                  <snm>Brussaard</snm>
                  <fnm>C</fnm>
               </au>
               <au>
                  <snm>Delaroque</snm>
                  <fnm>N</fnm>
               </au>
               <au>
                  <snm>Bratbak</snm>
                  <fnm>G</fnm>
               </au>
               <au>
                  <snm>Suttle</snm>
                  <fnm>C</fnm>
               </au>
            </aug>
            <source>Virus Taxonomy, VIIIth ICTV Report</source>
            <publisher>London: Elsevier/Academic Press</publisher>
            <editor>Fauquet CM, Mayo MA, Maniloff J, Dusselberger U, Ball LA</editor>
            <pubdate>2005</pubdate>
            <fpage>163</fpage>
            <lpage>175</lpage>
         </bibl>
         <bibl id="B5">
            <title>
               <p>Complete Genome Sequence and Lytic Phase Transcription Profile of a Coccolithovirus</p>
            </title>
            <aug>
               <au>
                  <snm>Wilson</snm>
                  <fnm>WH</fnm>
               </au>
               <au>
                  <snm>Schroeder</snm>
                  <fnm>DC</fnm>
               </au>
               <au>
                  <snm>Allen</snm>
                  <fnm>MJ</fnm>
               </au>
               <au>
                  <snm>Holden</snm>
                  <fnm>MTG</fnm>
               </au>
               <au>
                  <snm>Parkhill</snm>
                  <fnm>J</fnm>
               </au>
               <au>
                  <snm>Barrell</snm>
                  <fnm>BG</fnm>
               </au>
               <au>
                  <snm>Churcher</snm>
                  <fnm>C</fnm>
               </au>
               <au>
                  <snm>Hamlin</snm>
                  <fnm>N</fnm>
               </au>
               <au>
                  <snm>Mungall</snm>
                  <fnm>K</fnm>
               </au>
               <au>
                  <snm>Norbertczak</snm>
                  <fnm>H</fnm>
               </au>
               <etal/>
            </aug>
            <source>Science</source>
            <pubdate>2005</pubdate>
            <volume>309</volume>
            <fpage>1090</fpage>
            <lpage>1092</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1126/science.1113109</pubid>
                  <pubid idtype="pmpid" link="fulltext">16099989</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B6">
            <title>
               <p>A genetic marker to separate Emiliania huxleyi (Prymnesiophyceae) morphotypes</p>
            </title>
            <aug>
               <au>
                  <snm>Schroeder</snm>
                  <fnm>DC</fnm>
               </au>
               <au>
                  <snm>Biggi</snm>
                  <fnm>GF</fnm>
               </au>
               <au>
                  <snm>Hall</snm>
                  <fnm>M</fnm>
               </au>
               <au>
                  <snm>Davy</snm>
                  <fnm>J</fnm>
               </au>
               <au>
                  <snm>Martinez-Martinez</snm>
                  <fnm>J</fnm>
               </au>
               <au>
                  <snm>Richardson</snm>
                  <fnm>AJ</fnm>
               </au>
               <au>
                  <snm>Malin</snm>
                  <fnm>G</fnm>
               </au>
               <au>
                  <snm>Wilson</snm>
                  <fnm>WH</fnm>
               </au>
            </aug>
            <source>Journal of Phycology</source>
            <pubdate>2005</pubdate>
            <volume>41</volume>
            <fpage>874</fpage>
            <lpage>879</lpage>
            <xrefbib>
               <pubid idtype="doi">10.1111/j.1529-8817.2005.04188.x</pubid>
            </xrefbib>
         </bibl>
         <bibl id="B7">
            <title>
               <p>Matrix Science</p>
            </title>
            <url>http://www.matrixscience.com</url>
         </bibl>
         <bibl id="B8">
            <title>
               <p>Pride Database</p>
            </title>
            <url>http://www.ebi.ac.uk/pride/</url>
         </bibl>
         <bibl id="B9">
            <title>
               <p>InterProScan &#8211; an integration platform for the signature-recognition methods in InterPro</p>
            </title>
            <aug>
               <au>
                  <snm>Zdobnov</snm>
                  <fnm>EM</fnm>
               </au>
               <au>
                  <snm>Apweiler</snm>
                  <fnm>R</fnm>
               </au>
            </aug>
            <source>Bioinformatics</source>
            <pubdate>2001</pubdate>
            <volume>17</volume>
            <fpage>847</fpage>
            <lpage>848</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1093/bioinformatics/17.9.847</pubid>
                  <pubid idtype="pmpid" link="fulltext">11590104</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B10">
            <title>
               <p>InterProScan</p>
            </title>
            <url>http://www.ebi.ac.uk/InterProScan/</url>
         </bibl>
         <bibl id="B11">
            <title>
               <p>Basic local alignment search tool</p>
            </title>
            <aug>
               <au>
                  <snm>Altschul</snm>
                  <fnm>SF</fnm>
               </au>
               <au>
                  <snm>Gish</snm>
                  <fnm>W</fnm>
               </au>
               <au>
                  <snm>Miller</snm>
                  <fnm>W</fnm>
               </au>
               <au>
                  <snm>Myers</snm>
                  <fnm>EW</fnm>
               </au>
               <au>
                  <snm>Lipman</snm>
                  <fnm>DJ</fnm>
               </au>
            </aug>
            <source>J Mol Biol</source>
            <pubdate>1990</pubdate>
            <volume>215</volume>
            <fpage>403</fpage>
            <lpage>410</lpage>
            <xrefbib>
               <pubid idtype="pmpid" link="fulltext">2231712</pubid>
            </xrefbib>
         </bibl>
         <bibl id="B12">
            <title>
               <p>Basic Local Alignment Search Tool</p>
            </title>
            <url>http://www.ncbi.nlm.nih.gov/blast</url>
         </bibl>
         <bibl id="B13">
            <title>
               <p>The HMMTOP transmembrane topology prediction server</p>
            </title>
            <aug>
               <au>
                  <snm>Tusnady</snm>
                  <fnm>GE</fnm>
               </au>
               <au>
                  <snm>Simon</snm>
                  <fnm>I</fnm>
               </au>
            </aug>
            <source>Bioinformatics</source>
            <pubdate>2001</pubdate>
            <volume>17</volume>
            <fpage>849</fpage>
            <lpage>850</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1093/bioinformatics/17.9.849</pubid>
                  <pubid idtype="pmpid" link="fulltext">11590105</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B14">
            <title>
               <p>The structure and evolution of the major capsid protein of a large, lipid-containing DNA virus</p>
            </title>
            <aug>
               <au>
                  <snm>Nandhagopal</snm>
                  <fnm>N</fnm>
               </au>
               <au>
                  <snm>Simpson</snm>
                  <fnm>AA</fnm>
               </au>
               <au>
                  <snm>Gurnon</snm>
                  <fnm>JR</fnm>
               </au>
               <au>
                  <snm>Yan</snm>
                  <fnm>X</fnm>
               </au>
               <au>
                  <snm>Baker</snm>
                  <fnm>TS</fnm>
               </au>
               <au>
                  <snm>Graves</snm>
                  <fnm>MV</fnm>
               </au>
               <au>
                  <snm>Van Etten</snm>
                  <fnm>JL</fnm>
               </au>
               <au>
                  <snm>Rossmann</snm>
                  <fnm>MG</fnm>
               </au>
            </aug>
            <source>Proc Natl Acad Sci USA</source>
            <pubdate>2002</pubdate>
            <volume>99</volume>
            <fpage>14758</fpage>
            <lpage>14763</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">137492</pubid>
                  <pubid idtype="pmpid" link="fulltext">12411581</pubid>
                  <pubid idtype="doi">10.1073/pnas.232580699</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B15">
            <title>
               <p>Icosahedral RNA virus structure</p>
            </title>
            <aug>
               <au>
                  <snm>Rossmann</snm>
                  <fnm>MG</fnm>
               </au>
               <au>
                  <snm>Johnson</snm>
                  <fnm>JE</fnm>
               </au>
            </aug>
            <source>Annu Rev Biochem</source>
            <pubdate>1989</pubdate>
            <volume>58</volume>
            <fpage>533</fpage>
            <lpage>573</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1146/annurev.bi.58.070189.002533</pubid>
                  <pubid idtype="pmpid" link="fulltext">2673017</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B16">
            <title>
               <p>Structural analyses of Phycodnaviridae and Iridoviridae</p>
            </title>
            <aug>
               <au>
                  <snm>Simpson</snm>
                  <fnm>AA</fnm>
               </au>
               <au>
                  <snm>Nandhagopal</snm>
                  <fnm>N</fnm>
               </au>
               <au>
                  <snm>Van Etten</snm>
                  <fnm>JL</fnm>
               </au>
               <au>
                  <snm>Rossmann</snm>
                  <fnm>MG</fnm>
               </au>
            </aug>
            <source>Acta Crystallogr D Biol Crystallogr</source>
            <pubdate>2003</pubdate>
            <volume>59</volume>
            <fpage>2053</fpage>
            <lpage>2059</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1107/S090744490302225X</pubid>
                  <pubid idtype="pmpid" link="fulltext">14646061</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B17">
            <title>
               <p>Structure and assembly of large lipid-containing dsDNA viruses</p>
            </title>
            <aug>
               <au>
                  <snm>Yan</snm>
                  <fnm>X</fnm>
               </au>
               <au>
                  <snm>Olson</snm>
                  <fnm>NH</fnm>
               </au>
               <au>
                  <snm>Van Etten</snm>
                  <fnm>JL</fnm>
               </au>
               <au>
                  <snm>Bergoin</snm>
                  <fnm>M</fnm>
               </au>
               <au>
                  <snm>Rossmann</snm>
                  <fnm>MG</fnm>
               </au>
               <au>
                  <snm>Baker</snm>
                  <fnm>TS</fnm>
               </au>
            </aug>
            <source>Nat Struct Biol</source>
            <pubdate>2000</pubdate>
            <volume>7</volume>
            <fpage>101</fpage>
            <lpage>103</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1038/72360</pubid>
                  <pubid idtype="pmpid" link="fulltext">10655609</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B18">
            <title>
               <p>Expression of a novel marine viral single-chain serine palmitoyltransferase and construction of yeast and mammalian single-chain chimera</p>
            </title>
            <aug>
               <au>
                  <snm>Han</snm>
                  <fnm>G</fnm>
               </au>
               <au>
                  <snm>Gable</snm>
                  <fnm>K</fnm>
               </au>
               <au>
                  <snm>Yan</snm>
                  <fnm>L</fnm>
               </au>
               <au>
                  <snm>Allen</snm>
                  <fnm>MJ</fnm>
               </au>
               <au>
                  <snm>Wilson</snm>
                  <fnm>WH</fnm>
               </au>
               <au>
                  <snm>Moitra</snm>
                  <fnm>P</fnm>
               </au>
               <au>
                  <snm>Harmon</snm>
                  <fnm>JM</fnm>
               </au>
               <au>
                  <snm>Dunn</snm>
                  <fnm>TM</fnm>
               </au>
            </aug>
            <source>J Biol Chem</source>
            <pubdate>2006</pubdate>
            <volume>281</volume>
            <fpage>39935</fpage>
            <lpage>39942</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1074/jbc.M609365200</pubid>
                  <pubid idtype="pmpid" link="fulltext">17090526</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B19">
            <title>
               <p>Mechanisms of enveloped virus release</p>
            </title>
            <aug>
               <au>
                  <snm>Freed</snm>
                  <fnm>EO</fnm>
               </au>
            </aug>
            <source>Virus Res</source>
            <pubdate>2004</pubdate>
            <volume>106</volume>
            <fpage>85</fpage>
            <lpage>86</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1016/j.virusres.2004.08.006</pubid>
                  <pubid idtype="pmpid" link="fulltext">15567489</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B20">
            <title>
               <p>Thioredoxin and related molecules &#8211; from biology to health and disease</p>
            </title>
            <aug>
               <au>
                  <snm>Lillig</snm>
                  <fnm>CH</fnm>
               </au>
               <au>
                  <snm>Holmgren</snm>
                  <fnm>A</fnm>
               </au>
            </aug>
            <source>Antioxid Redox Signal</source>
            <pubdate>2007</pubdate>
            <volume>9</volume>
            <fpage>25</fpage>
            <lpage>47</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1089/ars.2007.9.25</pubid>
                  <pubid idtype="pmpid" link="fulltext">17115886</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B21">
            <title>
               <p>Infectious titres of Emiliania huxleyi virus 86 are reduced by exposure to millimolar dimethyl sulphide and acrylic acid</p>
            </title>
            <aug>
               <au>
                  <snm>Evans</snm>
                  <fnm>C</fnm>
               </au>
               <au>
                  <snm>Malin</snm>
                  <fnm>G</fnm>
               </au>
               <au>
                  <snm>WH</snm>
                  <fnm>W</fnm>
               </au>
               <au>
                  <snm>Liss</snm>
                  <fnm>PS</fnm>
               </au>
            </aug>
            <source>Limnology and Oceanography</source>
            <pubdate>2006</pubdate>
            <volume>51</volume>
            <fpage>2468</fpage>
            <lpage>2471</lpage>
         </bibl>
         <bibl id="B22">
            <title>
               <p>Viral infection of Emiliania huxleyi (Prymnesiophyceae) leads to elevated production of reactive oxygen species</p>
            </title>
            <aug>
               <au>
                  <snm>Evans</snm>
                  <fnm>C</fnm>
               </au>
               <au>
                  <snm>Malin</snm>
                  <fnm>G</fnm>
               </au>
               <au>
                  <snm>Mills</snm>
                  <fnm>GP</fnm>
               </au>
               <au>
                  <snm>Wilson</snm>
                  <fnm>WH</fnm>
               </au>
            </aug>
            <pubdate>2006</pubdate>
            <volume>42</volume>
            <fpage>1040</fpage>
            <lpage>1047</lpage>
         </bibl>
         <bibl id="B23">
            <title>
               <p>Mimivirus giant particles incorporate a large fraction of anonymous and unique gene products</p>
            </title>
            <aug>
               <au>
                  <snm>Renesto</snm>
                  <fnm>P</fnm>
               </au>
               <au>
                  <snm>Abergel</snm>
                  <fnm>C</fnm>
               </au>
               <au>
                  <snm>Decloquement</snm>
                  <fnm>P</fnm>
               </au>
               <au>
                  <snm>Moinier</snm>
                  <fnm>D</fnm>
               </au>
               <au>
                  <snm>Azza</snm>
                  <fnm>S</fnm>
               </au>
               <au>
                  <snm>Ogata</snm>
                  <fnm>H</fnm>
               </au>
               <au>
                  <snm>Fourquet</snm>
                  <fnm>P</fnm>
               </au>
               <au>
                  <snm>Gorvel</snm>
                  <fnm>JP</fnm>
               </au>
               <au>
                  <snm>Claverie</snm>
                  <fnm>JM</fnm>
               </au>
            </aug>
            <source>J Virol</source>
            <pubdate>2006</pubdate>
            <volume>80</volume>
            <fpage>11678</fpage>
            <lpage>11685</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">1642625</pubid>
                  <pubid idtype="pmpid" link="fulltext">16971431</pubid>
                  <pubid idtype="doi">10.1128/JVI.00940-06</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B24">
            <title>
               <p>Vaccinia virus proteome: identification of proteins in vaccinia virus intracellular mature virion particles</p>
            </title>
            <aug>
               <au>
                  <snm>Chung</snm>
                  <fnm>CS</fnm>
               </au>
               <au>
                  <snm>Chen</snm>
                  <fnm>CH</fnm>
               </au>
               <au>
                  <snm>Ho</snm>
                  <fnm>MY</fnm>
               </au>
               <au>
                  <snm>Huang</snm>
                  <fnm>CY</fnm>
               </au>
               <au>
                  <snm>Liao</snm>
                  <fnm>CL</fnm>
               </au>
               <au>
                  <snm>Chang</snm>
                  <fnm>W</fnm>
               </au>
            </aug>
            <source>J Virol</source>
            <pubdate>2006</pubdate>
            <volume>80</volume>
            <fpage>2127</fpage>
            <lpage>2140</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">1395410</pubid>
                  <pubid idtype="pmpid" link="fulltext">16474121</pubid>
                  <pubid idtype="doi">10.1128/JVI.80.5.2127-2140.2006</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B25">
            <title>
               <p>Locus-specific gene expression pattern suggests a unique propagation strategy for a giant algal virus</p>
            </title>
            <aug>
               <au>
                  <snm>Allen</snm>
                  <fnm>MJ</fnm>
               </au>
               <au>
                  <snm>Forster</snm>
                  <fnm>T</fnm>
               </au>
               <au>
                  <snm>Schroeder</snm>
                  <fnm>DC</fnm>
               </au>
               <au>
                  <snm>Hall</snm>
                  <fnm>M</fnm>
               </au>
               <au>
                  <snm>Roy</snm>
                  <fnm>D</fnm>
               </au>
               <au>
                  <snm>Ghazal</snm>
                  <fnm>P</fnm>
               </au>
               <au>
                  <snm>Wilson</snm>
                  <fnm>WH</fnm>
               </au>
            </aug>
            <source>J Virol</source>
            <pubdate>2006</pubdate>
            <volume>80</volume>
            <fpage>7699</fpage>
            <lpage>7705</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmcid">1563701</pubid>
                  <pubid idtype="pmpid" link="fulltext">16840348</pubid>
                  <pubid idtype="doi">10.1128/JVI.00491-06</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B26">
            <title>
               <p>Evolutionary History of the Coccolithoviridae</p>
            </title>
            <aug>
               <au>
                  <snm>Allen</snm>
                  <fnm>MJ</fnm>
               </au>
               <au>
                  <snm>Schroeder</snm>
                  <fnm>DC</fnm>
               </au>
               <au>
                  <snm>Holden</snm>
                  <fnm>MT</fnm>
               </au>
               <au>
                  <snm>Wilson</snm>
                  <fnm>WH</fnm>
               </au>
            </aug>
            <source>Mol Biol Evol</source>
            <pubdate>2006</pubdate>
            <volume>23</volume>
            <fpage>86</fpage>
            <lpage>92</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1093/molbev/msj010</pubid>
                  <pubid idtype="pmpid" link="fulltext">16151186</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B27">
            <title>
               <p>Preliminary characterisation of repeat families in the genome of EhV-86, a giant algal virus that infects the marine microalga <it>Emiliania huxleyi</it></p>
            </title>
            <aug>
               <au>
                  <snm>Allen</snm>
                  <fnm>MJ</fnm>
               </au>
               <au>
                  <snm>Schroeder</snm>
                  <fnm>DC</fnm>
               </au>
               <au>
                  <snm>Wilson</snm>
                  <fnm>WH</fnm>
               </au>
            </aug>
            <source>Arch Virol</source>
            <pubdate>2006</pubdate>
            <volume>151</volume>
            <fpage>525</fpage>
            <lpage>535</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1007/s00705-005-0647-1</pubid>
                  <pubid idtype="pmpid" link="fulltext">16195784</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B28">
            <title>
               <p>Viral activation and recruitment of metacaspases in the unicellular coccolithophore, Emiliania huxleyi</p>
            </title>
            <aug>
               <au>
                  <snm>Bidle</snm>
                  <fnm>KD</fnm>
               </au>
               <au>
                  <snm>Haramaty</snm>
                  <fnm>L</fnm>
               </au>
               <au>
                  <snm>Barcelos e Ramos</snm>
                  <fnm>J</fnm>
               </au>
               <au>
                  <snm>Falkowski</snm>
                  <fnm>P</fnm>
               </au>
            </aug>
            <source>PNAS</source>
            <pubdate>2007</pubdate>
            <volume>104</volume>
            <issue>14</issue>
            <fpage>6049</fpage>
            <lpage>6054</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="pmpid" link="fulltext">17392426</pubid>
                  <pubid idtype="pmcid">1838821</pubid>
                  <pubid idtype="doi">10.1073/pnas.0701240104</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B29">
            <title>
               <p>Ceramide mediates caspase-independent programmed cell death</p>
            </title>
            <aug>
               <au>
                  <snm>Thon</snm>
                  <fnm>L</fnm>
               </au>
               <au>
                  <snm>Mohlig</snm>
                  <fnm>H</fnm>
               </au>
               <au>
                  <snm>Mathieu</snm>
                  <fnm>S</fnm>
               </au>
               <au>
                  <snm>Lange</snm>
                  <fnm>A</fnm>
               </au>
               <au>
                  <snm>Bulanova</snm>
                  <fnm>E</fnm>
               </au>
               <au>
                  <snm>Winoto-Morbach</snm>
                  <fnm>S</fnm>
               </au>
               <au>
                  <snm>Schutze</snm>
                  <fnm>S</fnm>
               </au>
               <au>
                  <snm>Bulfone-Paus</snm>
                  <fnm>S</fnm>
               </au>
               <au>
                  <snm>Adam</snm>
                  <fnm>D</fnm>
               </au>
            </aug>
            <source>Faseb J</source>
            <pubdate>2005</pubdate>
            <volume>19</volume>
            <fpage>1945</fpage>
            <lpage>1956</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1096/fj.05-3726com</pubid>
                  <pubid idtype="pmpid" link="fulltext">16319138</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
         <bibl id="B30">
            <title>
               <p>Use of microarrays to assess viral diversity: from genotype to phenotype</p>
            </title>
            <aug>
               <au>
                  <snm>Allen</snm>
                  <fnm>MJ</fnm>
               </au>
               <au>
                  <snm>Martinez-Martinez</snm>
                  <fnm>J</fnm>
               </au>
               <au>
                  <snm>Schroeder</snm>
                  <fnm>DC</fnm>
               </au>
               <au>
                  <snm>Somerfield</snm>
                  <fnm>PJ</fnm>
               </au>
               <au>
                  <snm>Wilson</snm>
                  <fnm>WH</fnm>
               </au>
            </aug>
            <source>Environ Microbiol</source>
            <pubdate>2007</pubdate>
            <volume>9</volume>
            <fpage>971</fpage>
            <lpage>982</lpage>
            <xrefbib>
               <pubidlist>
                  <pubid idtype="doi">10.1111/j.1462-2920.2006.01219.x</pubid>
                  <pubid idtype="pmpid" link="fulltext">17359269</pubid>
               </pubidlist>
            </xrefbib>
         </bibl>
      </refgrp>
   </bm>
</art>
